Home > Browse Alphabetical by Name > V

1 2 3 4 Next > Result 1 - 50 of 163, 50 per Page
VAS2870

VAS2870

CAS No:722456-31-7 Catalog No.:HY-12804

Brief Description:

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 5mg €55 ( In-stock ); 10mg €100 ( In-stock ); 25mg €191 ( In-stock ); 50mg €346 ( In-stock ); 100mg €619 ( In-stock );

Inquiry Online More Info >
Vildagliptin dihydrate

Vildagliptin dihydrate

CAS No:2133364-01-7 Catalog No.:HY-14291A

Brief Description:

Price and Availability: 10mg €46 ( Backordered ); 50mg €64 ( Backordered ); 100mg €91 ( Backordered );

Inquiry Online More Info >
Vibunazole

Vibunazole

CAS No:80456-55-9 Catalog No.:HY-100121

Brief Description:

Price and Availability: 5mg €137 ( Backordered ); 10mg €219 ( Backordered );

Inquiry Online More Info >
Vanillin

Vanillin

CAS No:121-33-5 Catalog No.:HY-N0098

Brief Description:

Price and Availability: 10 mM * 1 mL €50 ( In-stock ); 200mg €46 ( In-stock ); 5g €64 ( In-stock );

Inquiry Online More Info >
Vofopitant

Vofopitant

CAS No:168266-90-8 Catalog No.:HY-12142

Brief Description:

Price and Availability: 5mg €319 ( Backordered ); 10mg €592 ( Backordered ); 25mg €1321 ( Backordered );

Inquiry Online More Info >
VU6005649

VU6005649

CAS No:2137047-43-7 Catalog No.:HY-107982

Brief Description:

Price and Availability: 10 mM * 1 mL €507 ( In-stock ); 1mg €208 ( In-stock ); 5mg €645 ( In-stock ); 10mg €973 ( In-stock ); 25mg €1957 ( In-stock ); 50mg €2952 ( In-stock ); 100mg €4045 ( In-stock );

Inquiry Online More Info >
Valpromide

Valpromide

CAS No:2430-27-5 Catalog No.:HY-B2117

Brief Description:

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 10mg €55 ( In-stock ); 50mg €164 ( In-stock ); 100mg €230 ( In-stock );

Inquiry Online More Info >
Vitamin K4

Vitamin K4

CAS No:573-20-6 Catalog No.:HY-B1508

Brief Description:

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 200mg €55 ( In-stock ); 1g €98 ( In-stock );

Inquiry Online More Info >
Vitamin CK3

Vitamin CK3

CAS No:1085703-32-7 Catalog No.:HY-16516

Brief Description:

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 100mg €55 ( In-stock );

Inquiry Online More Info >
Verucerfont

Verucerfont

CAS No:885220-61-1 Catalog No.:HY-14875

Brief Description:

Price and Availability: 10 mM * 1 mL €577 ( In-stock ); 1mg €208 ( In-stock ); 5mg €645 ( In-stock ); 10mg €1082 ( In-stock ); 50mg €3269 ( In-stock ); 100mg €4362 ( In-stock );

Inquiry Online More Info >
Visomitin

Visomitin

CAS No:934826-68-3 Catalog No.:HY-100474

Brief Description:

Price and Availability: 10 mM * 1 mL €89 ( In-stock ); 5mg €66 ( In-stock ); 10mg €109 ( In-stock ); 25mg €241 ( In-stock ); 50mg €448 ( In-stock ); 100mg €864 ( In-stock );

Inquiry Online More Info >
Vps34-IN-2

Vps34-IN-2

CAS No:1523404-29-6 Catalog No.:HY-12473

Brief Description:

Price and Availability: 10 mM * 1 mL €571 ( In-stock ); 1mg €208 ( In-stock ); 5mg €645 ( In-stock ); 10mg €973 ( In-stock ); 25mg €2077 ( In-stock ); 50mg €3717 ( In-stock );

Inquiry Online More Info >
VI 16832

VI 16832

CAS No:1430218-51-1 Catalog No.:HY-18623

Brief Description:

Price and Availability: 10 mM * 1 mL €311 ( In-stock ); 1mg €120 ( In-stock ); 5mg €361 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

CAS No: Catalog No.:HY-P1225

Brief Description:

Price and Availability: 10 mM * 1 mL €5848 ( In-stock ); 1mg €306 ( In-stock ); 5mg €1071 ( In-stock ); 10mg €1640 ( In-stock );

Inquiry Online More Info >
Vorasidenib

Vorasidenib

CAS No:1644545-52-7 Catalog No.:HY-104042

Brief Description:

Price and Availability: 10 mM * 1 mL €189 ( In-stock ); 2mg €120 ( In-stock ); 5mg €208 ( In-stock ); 10mg €317 ( In-stock ); 50mg €973 ( In-stock ); 100mg €1312 ( In-stock );

Inquiry Online More Info >
VH-298

VH-298

CAS No:2097381-85-4 Catalog No.:HY-100947

Brief Description:

Price and Availability: 10 mM * 1 mL €147 ( In-stock ); 2mg €64 ( In-stock ); 5mg €128 ( In-stock ); 10mg €219 ( In-stock ); 50mg €683 ( In-stock ); 100mg €1093 ( In-stock );

Inquiry Online More Info >
VIP(6-28)(human, rat, porcine, bovine)

VIP(6-28)(human, rat, porcine, bovine)

CAS No:69698-54-0 Catalog No.:HY-P1023

Brief Description:

Price and Availability: 10 mM * 1 mL €5080 ( In-stock ); 500ug €153 ( In-stock ); 1mg €208 ( In-stock ); 5mg €820 ( In-stock );

Inquiry Online More Info >
Valrocemide

Valrocemide

CAS No:92262-58-3 Catalog No.:HY-100379

Brief Description:

Price and Availability: 10 mM * 1 mL €132 ( In-stock ); 5mg €120 ( In-stock ); 10mg €197 ( In-stock ); 25mg €383 ( In-stock ); 50mg €601 ( In-stock ); 100mg €929 ( In-stock );

Inquiry Online More Info >
Verilopam

Verilopam

CAS No:68318-20-7 Catalog No.:HY-U00338

Brief Description:

Price and Availability: 1mg €1115 ( Backordered ); 5mg €2219 ( Backordered ); 10mg €3772 ( Backordered ); 20mg €6658 ( Backordered );

Inquiry Online More Info >
Vinconate

Vinconate

CAS No:70704-03-9 Catalog No.:HY-U00316

Brief Description:

Price and Availability: 1mg €634 ( Backordered ); 5mg €1257 ( Backordered ); 10mg €2143 ( Backordered ); 20mg €3772 ( Backordered );

Inquiry Online More Info >
Vericiguat

Vericiguat

CAS No:1350653-20-1 Catalog No.:HY-16774

Brief Description:

Price and Availability: 10 mM * 1 mL €226 ( In-stock ); 2mg €120 ( In-stock ); 5mg €241 ( In-stock ); 10mg €383 ( In-stock ); 50mg €1039 ( In-stock ); 100mg €1530 ( In-stock );

Inquiry Online More Info >
V5 Epitope Tag Peptide Trifluoroacetate

V5 Epitope Tag Peptide Trifluoroacetate

CAS No: Catalog No.:HY-P0325

Brief Description:

Price and Availability: 10 mM * 1 mL €388 ( In-stock ); 1mg €66 ( In-stock ); 5mg €131 ( In-stock ); 10mg €230 ( In-stock );

Inquiry Online More Info >
VSV-G Peptide

VSV-G Peptide

CAS No: Catalog No.:HY-P0328

Brief Description:

Price and Availability: 1mg €55 ( Backordered ); 5mg €120 ( Backordered ); 10mg €208 ( Backordered );

Inquiry Online More Info >
Veledimex

Veledimex

CAS No:1093130-72-3 Catalog No.:HY-16785

Brief Description:

Price and Availability: 10 mM * 1 mL €369 ( In-stock ); 1mg €164 ( In-stock ); 5mg €383 ( In-stock ); 10mg €656 ( In-stock ); 25mg €1312 ( In-stock ); 50mg €2077 ( In-stock );

Inquiry Online More Info >
Veledimex S enantiomer

Veledimex S enantiomer

CAS No:1093131-03-3 Catalog No.:HY-16785B

Brief Description:

Price and Availability: 10 mM * 1 mL €791 ( In-stock ); 1mg €273 ( In-stock ); 5mg €820 ( In-stock ); 10mg €1203 ( In-stock );

Inquiry Online More Info >
Veledimex racemate

Veledimex racemate

CAS No:755013-59-3 Catalog No.:HY-16785A

Brief Description:

Price and Availability: 1mg €164 ( Backordered ); 5mg €383 ( Backordered ); 10mg €656 ( Backordered ); 25mg €1312 ( Backordered ); 50mg €2077 ( Backordered );

Inquiry Online More Info >
Veralipride

Veralipride

CAS No:66644-81-3 Catalog No.:HY-101797

Brief Description:

Price and Availability: 10 mM * 1 mL €175 ( In-stock ); 2mg €98 ( In-stock ); 5mg €208 ( In-stock ); 10mg €350 ( In-stock ); 50mg €1257 ( In-stock ); 100mg €2077 ( In-stock );

Inquiry Online More Info >
Varespladib methyl

Varespladib methyl

CAS No:172733-08-3 Catalog No.:HY-17448

Brief Description:

Price and Availability: 1mg €328 ( Backordered );

Inquiry Online More Info >
Vitamin K

Vitamin K

CAS No:12001-79-5 Catalog No.:HY-B2172

Brief Description:

Price and Availability: 50mg €55 ( Backordered ); 100mg €77 ( Backordered ); 500mg €131 ( Backordered );

Inquiry Online More Info >
Vaborbactam

Vaborbactam

CAS No:1360457-46-0 Catalog No.:HY-19930

Brief Description:

Price and Availability: 10 mM * 1 mL €393 ( In-stock ); 1mg €120 ( In-stock ); 5mg €383 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
VUF10460

VUF10460

CAS No:1028327-66-3 Catalog No.:HY-101420

Brief Description:

Price and Availability: 10 mM * 1 mL €97 ( In-stock ); 5mg €87 ( In-stock ); 10mg €131 ( In-stock ); 25mg €295 ( In-stock ); 50mg €459 ( In-stock ); 100mg €831 ( In-stock );

Inquiry Online More Info >
Vitamin K1

Vitamin K1

CAS No:84-80-0 Catalog No.:HY-N0684

Brief Description:

Price and Availability: 10 mM * 1 mL €84 ( In-stock ); 1g €77 ( In-stock ); 5g €241 ( In-stock );

Inquiry Online More Info >
Vadadustat

Vadadustat

CAS No:1000025-07-9 Catalog No.:HY-101277

Brief Description:

Price and Availability: 10 mM * 1 mL €107 ( In-stock ); 2mg €64 ( In-stock ); 5mg €109 ( In-stock ); 10mg €173 ( In-stock ); 50mg €446 ( In-stock ); 100mg €629 ( In-stock );

Inquiry Online More Info >
Vapreotide acetate

Vapreotide acetate

CAS No:849479-74-9 Catalog No.:HY-P0061A

Brief Description:

Price and Availability: 10 mM * 1 mL €401 ( In-stock ); 1mg €120 ( In-stock ); 5mg €241 ( In-stock ); 10mg €306 ( In-stock ); 50mg €656 ( In-stock );

Inquiry Online More Info >
Vps34-PIK-III

Vps34-PIK-III

CAS No:1383716-40-2 Catalog No.:HY-12794

Brief Description:

Price and Availability: 10 mM * 1 mL €135 ( In-stock ); 2mg €77 ( In-stock ); 5mg €142 ( In-stock ); 10mg €230 ( In-stock ); 25mg €514 ( In-stock ); 50mg €918 ( In-stock ); 100mg €1640 ( In-stock );

Inquiry Online More Info >
Vanilpyruvic acid

Vanilpyruvic acid

CAS No:1081-71-6 Catalog No.:HY-101416

Brief Description:

Price and Availability: 10 mM * 1 mL €84 ( In-stock ); 10mg €77 ( In-stock );

Inquiry Online More Info >
VU0364770

VU0364770

CAS No:61350-00-3 Catalog No.:HY-100588

Brief Description:

Price and Availability: 10 mM * 1 mL €72 ( In-stock ); 5mg €66 ( In-stock ); 10mg €98 ( In-stock ); 50mg €350 ( In-stock ); 100mg €547 ( In-stock );

Inquiry Online More Info >
Velpatasvir

Velpatasvir

CAS No:1377049-84-7 Catalog No.:HY-12530

Brief Description: Velpatasvir (VEL, GS-5816) is a novel pan-genotypic hepatitis C virus (HCV) nonstructural protein 5A (NS5A) inhibitor with activity against genotype 1 (GT1) to GT6 HCV replicons.

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 10mg €55 ( In-stock ); 50mg €131 ( In-stock ); 100mg €208 ( In-stock );

Inquiry Online More Info >
Vapreotide

Vapreotide

CAS No:103222-11-3 Catalog No.:HY-P0061

Brief Description:

Price and Availability: 10 mM * 1 mL €381 ( In-stock ); 1mg €120 ( In-stock ); 5mg €241 ( In-stock ); 10mg €306 ( In-stock ); 50mg €656 ( In-stock );

Inquiry Online More Info >
Valbenazine

Valbenazine

CAS No:1025504-45-3 Catalog No.:HY-16771

Brief Description:

Price and Availability: 10 mM * 1 mL €141 ( In-stock ); 2mg €77 ( In-stock ); 5mg €153 ( In-stock ); 10mg €230 ( In-stock ); 25mg €492 ( In-stock ); 50mg €711 ( In-stock ); 100mg €1312 ( In-stock );

Inquiry Online More Info >
Verubecestat

Verubecestat

CAS No:1286770-55-5 Catalog No.:HY-16759

Brief Description: MK-8931 is a BACE1 inhibitor. MK-8931 binds significantly to β-secretase.

Price and Availability: 10 mM * 1 mL €97 ( In-stock ); 5mg €87 ( In-stock ); 10mg €131 ( In-stock ); 25mg €262 ( In-stock ); 50mg €459 ( In-stock ); 100mg €678 ( In-stock );

Inquiry Online More Info >
Val-Cit-PAB-MMAE

Val-Cit-PAB-MMAE

CAS No:644981-35-1 Catalog No.:HY-100374

Brief Description:

Price and Availability: 10 mM * 1 mL €1622 ( In-stock ); 1mg €383 ( In-stock ); 5mg €929 ( In-stock ); 10mg €1312 ( In-stock );

Inquiry Online More Info >
VLX1570

VLX1570

CAS No:1431280-51-1 Catalog No.:HY-12471

Brief Description:

Price and Availability: 10 mM * 1 mL €395 ( In-stock ); 1mg €164 ( In-stock ); 5mg €383 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
Vitamin D2

Vitamin D2

CAS No:50-14-6 Catalog No.:HY-76542

Brief Description: Vitamin D2 (Ergocalciferol) is a form of vitamin D, used as a vitamin D supplement.

Price and Availability: 5g €77 ( In-stock ); 10g €131 ( In-stock );

Inquiry Online More Info >
Vorapaxar

Vorapaxar

CAS No:618385-01-6 Catalog No.:HY-10119

Brief Description: Vorapaxar is a thrombin receptor (protease-activated receptor, PAR-1) antagonist.

Price and Availability: 10 mM * 1 mL €169 ( In-stock ); 5mg €153 ( In-stock ); 10mg €262 ( In-stock ); 25mg €547 ( In-stock ); 50mg €820 ( In-stock );

Inquiry Online More Info >
VU0357017 hydrochloride

VU0357017 hydrochloride

CAS No:1135242-13-5 Catalog No.:HY-19752A

Brief Description: VU0357017 hydrochloride is a highly selective M1 agonists that appear to act at an allosteric site to activate the receptor (EC50 = 477 ± 172 nM; pEC50 = 6.37 ± 0.15).

Price and Availability: 10 mM * 1 mL €84 ( In-stock ); 5mg €77 ( In-stock ); 10mg €131 ( In-stock ); 50mg €492 ( In-stock ); 100mg €875 ( In-stock );

Inquiry Online More Info >
Velneperit

Velneperit

CAS No:342577-38-2 Catalog No.:HY-14423

Brief Description: Velneperit (S-2367) is a novel neuropeptide Y (NPY) Y5 receptor antagonist.

Price and Availability: 10 mM * 1 mL €421 ( In-stock ); 5mg €383 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
Vesnarinone

Vesnarinone

CAS No:81840-15-5 Catalog No.:HY-15297

Brief Description: Vesnarinone is a quinolinone derivative, and its pharmacodynamic effects include inhibition of phosphodiesterase III (PDE3) activity, increases in calcium flux and decreases in potassium flux.

Price and Availability: 10 mM * 1 mL €421 ( In-stock ); 5mg €383 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
VU0361737

VU0361737

CAS No:1161205-04-4 Catalog No.:HY-14418

Brief Description: VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors, respectively, displays weak activity at mGlu5 and mGlu8 receptors, is inactive at mGlu1, mGlu2, mGlu3, mGlu6 and mGlu7 receptors.

Price and Availability: 10 mM * 1 mL €60 ( In-stock ); 5mg €55 ( In-stock ); 10mg €77 ( In-stock ); 50mg €262 ( In-stock ); 100mg €426 ( In-stock );

Inquiry Online More Info >
Vps34-IN-1

Vps34-IN-1

CAS No:1383716-33-3 Catalog No.:HY-12795

Brief Description:

Price and Availability: 10 mM * 1 mL €132 ( In-stock ); 5mg €120 ( In-stock ); 10mg €197 ( In-stock ); 50mg €656 ( In-stock ); 100mg €929 ( In-stock );

Inquiry Online More Info >
1 2 3 4 Next > Result 1 - 50 of 163, 50 per Page
Back to top