Home > pathway > Glucagon Receptor

1 Result 1 - 26 of 26, 50 per Page
Exendin-4

Exendin-4

CAS No:141758-74-9 Catalog No.:HY-13443

Brief Description:

Price and Availability: 10 mM * 1 mL €604 ( In-stock ); 1mg €66 ( In-stock ); 5mg €153 ( In-stock ); 10mg €230 ( In-stock ); 25mg €328 ( In-stock );

Inquiry Online More Info >
Liraglutide

Liraglutide

CAS No:204656-20-2 Catalog No.:HY-P0014

Brief Description:

Price and Availability: 1mg €131 ( In-stock ); 5mg €547 ( In-stock ); 10mg €984 ( In-stock );

Inquiry Online More Info >
Glucagon

Glucagon

CAS No:16941-32-5 Catalog No.:HY-P0082

Brief Description:

Price and Availability: 10 mM * 1 mL €921 ( In-stock ); 1mg €66 ( In-stock ); 5mg €197 ( In-stock ); 10mg €306 ( In-stock ); 25mg €601 ( In-stock ); 50mg €809 ( In-stock );

Inquiry Online More Info >
MK 0893

MK 0893

CAS No:870823-12-4 Catalog No.:HY-50663

Brief Description:

Price and Availability: 10 mM * 1 mL €445 ( In-stock ); 5mg €344 ( In-stock ); 10mg €623 ( In-stock ); 50mg €1558 ( In-stock );

Inquiry Online More Info >
Adomeglivant

Adomeglivant

CAS No:1488363-78-5 Catalog No.:HY-19904

Brief Description: Adomeglivant is a potent and selective glucagon receptor antagonist that is used in clinical trial for type 2 diabetes mellitus.

Price and Availability: 10 mM * 1 mL €134 ( In-stock ); 5mg €109 ( In-stock ); 10mg €164 ( In-stock ); 25mg €262 ( In-stock ); 50mg €481 ( In-stock ); 100mg €711 ( In-stock );

Inquiry Online More Info >
GLP-1(7-36) Acetate

GLP-1(7-36) Acetate

CAS No: Catalog No.:HY-P0054

Brief Description:

Price and Availability: 500ug €131 ( In-stock ); 1mg €219 ( In-stock ); 5mg €656 ( In-stock ); 10mg €1039 ( In-stock );

Inquiry Online More Info >
Exendin 9-39

Exendin 9-39

CAS No:133514-43-9 Catalog No.:HY-P0264

Brief Description:

Price and Availability: 10 mM * 1 mL €6565 ( In-stock ); 500ug €186 ( In-stock ); 1mg €295 ( In-stock ); 5mg €885 ( In-stock );

Inquiry Online More Info >
Lixisenatide

Lixisenatide

CAS No:320367-13-3 Catalog No.:HY-P0119

Brief Description:

Price and Availability: 10 mM * 1 mL €5784 ( In-stock ); 1mg €241 ( In-stock ); 5mg €722 ( In-stock ); 10mg €1082 ( In-stock );

Inquiry Online More Info >
GLP-1(7-37)

GLP-1(7-37)

CAS No:106612-94-6 Catalog No.:HY-P0055

Brief Description:

Price and Availability: 1mg €230 ( In-stock ); 5mg €394 ( In-stock ); 10mg €601 ( In-stock ); 25mg €984 ( In-stock );

Inquiry Online More Info >
Exendin-4 Acetate

Exendin-4 Acetate

CAS No:914454-01-6 Catalog No.:HY-13443A

Brief Description:

Price and Availability: 10 mM * 1 mL €1072 ( In-stock ); 1mg €66 ( In-stock ); 5mg €153 ( In-stock ); 10mg €230 ( In-stock );

Inquiry Online More Info >
Glucagon receptor antagonists-4

Glucagon receptor antagonists-4

CAS No:1393124-08-7 Catalog No.:HY-19947

Brief Description:

Price and Availability: 10 mM * 1 mL €424 ( In-stock ); 1mg €164 ( In-stock ); 5mg €383 ( In-stock ); 10mg €547 ( In-stock ); 50mg €1640 ( In-stock ); 100mg €2296 ( In-stock );

Inquiry Online More Info >
LGD-6972

LGD-6972

CAS No:1207989-09-0 Catalog No.:HY-12525

Brief Description:

Price and Availability: 10 mM * 1 mL €591 ( In-stock ); 1mg €164 ( In-stock ); 5mg €383 ( In-stock ); 10mg €601 ( In-stock ); 50mg €2022 ( In-stock ); 100mg €3006 ( In-stock );

Inquiry Online More Info >
Glucagon receptor antagonists-2

Glucagon receptor antagonists-2

CAS No:202917-18-8 Catalog No.:HY-50158

Brief Description:

Price and Availability: 10 mM * 1 mL €271 ( In-stock ); 5mg €247 ( In-stock ); 10mg €421 ( In-stock );

Inquiry Online More Info >
Glucagon receptor antagonists-1

Glucagon receptor antagonists-1

CAS No:503559-84-0 Catalog No.:HY-10036

Brief Description:

Price and Availability: 10 mM * 1 mL €271 ( In-stock ); 5mg €247 ( In-stock ); 10mg €444 ( In-stock ); 50mg €1515 ( In-stock );

Inquiry Online More Info >
Glucagon receptor antagonists-3

Glucagon receptor antagonists-3

CAS No:202917-17-7 Catalog No.:HY-50159

Brief Description:

Price and Availability: 10 mM * 1 mL €271 ( In-stock ); 5mg €247 ( In-stock ); 10mg €421 ( In-stock );

Inquiry Online More Info >
Taspoglutide

Taspoglutide

CAS No:275371-94-3 Catalog No.:HY-P0165

Brief Description:

Price and Availability: 10 mM * 1 mL €1606 ( In-stock ); 1mg €120 ( In-stock ); 5mg €361 ( In-stock ); 10mg €547 ( In-stock ); 25mg €1093 ( In-stock );

Inquiry Online More Info >
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

CAS No: Catalog No.:HY-P1231

Brief Description:

Price and Availability: 10 mM * 1 mL €6945 ( In-stock ); 1mg €306 ( In-stock ); 5mg €1071 ( In-stock ); 10mg €1640 ( In-stock );

Inquiry Online More Info >
HAEGTFTSD

HAEGTFTSD

CAS No: Catalog No.:HY-P1226

Brief Description:

Price and Availability: 10 mM * 1 mL €1020 ( In-stock ); 1mg €197 ( In-stock ); 5mg €634 ( In-stock ); 10mg €962 ( In-stock );

Inquiry Online More Info >
HAEGTFTSDVS

HAEGTFTSDVS

CAS No: Catalog No.:HY-P1224

Brief Description:

Price and Availability: 10 mM * 1 mL €1217 ( In-stock ); 1mg €197 ( In-stock ); 5mg €634 ( In-stock ); 10mg €962 ( In-stock );

Inquiry Online More Info >
HAEGTFT

HAEGTFT

CAS No: Catalog No.:HY-P1228

Brief Description:

Price and Availability: 10 mM * 1 mL €806 ( In-stock ); 1mg €197 ( In-stock ); 5mg €634 ( In-stock ); 10mg €962 ( In-stock );

Inquiry Online More Info >
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

CAS No: Catalog No.:HY-P1229

Brief Description:

Price and Availability: 10 mM * 1 mL €6659 ( In-stock ); 1mg €306 ( In-stock ); 5mg €1071 ( In-stock ); 10mg €1640 ( In-stock );

Inquiry Online More Info >
KQMEEEAVRLFIEWLKNGGPSSGAPPPS

KQMEEEAVRLFIEWLKNGGPSSGAPPPS

CAS No: Catalog No.:HY-P1223

Brief Description:

Price and Availability: 10 mM * 1 mL €5512 ( In-stock ); 1mg €306 ( In-stock ); 5mg €1071 ( In-stock ); 10mg €1640 ( In-stock );

Inquiry Online More Info >
Dulaglutide

Dulaglutide

CAS No:923950-08-7 Catalog No.:HY-P0120

Brief Description:

Price and Availability: 1mg €306 ( Backordered ); 5mg €962 ( Backordered ); 10mg €1530 ( Backordered );

Inquiry Online More Info >
GLP-1 moiety from Dulaglutide

GLP-1 moiety from Dulaglutide

CAS No: Catalog No.:HY-P1348

Brief Description:

Price and Availability: 10 mM * 1 mL €8769 ( In-stock ); 1mg €383 ( In-stock ); 5mg €1203 ( In-stock );

Inquiry Online More Info >
GRA Ex-25

GRA Ex-25

CAS No:307983-31-9 Catalog No.:HY-50675

Brief Description:

Price and Availability: 10 mM * 1 mL €203 ( In-stock ); 2mg €87 ( In-stock ); 5mg €164 ( In-stock ); 10mg €230 ( In-stock ); 50mg €765 ( In-stock ); 100mg €1312 ( In-stock );

Inquiry Online More Info >
GLP-2(1-33)(human)

GLP-2(1-33)(human)

CAS No:223460-79-5 Catalog No.:HY-P1024

Brief Description:

Price and Availability: 10 mM * 1 mL €6434 ( In-stock ); 500ug €164 ( In-stock ); 1mg €273 ( In-stock ); 5mg €1039 ( In-stock );

Inquiry Online More Info >
1 Result 1 - 26 of 26, 50 per Page
Back to top